General Information

  • ID:  hor000785
  • Uniprot ID:  P10362
  • Protein name:  Manserin
  • Gene name:  Scg2
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  [Manserin]: Brain. Expression in the pituitary is restricted to the anterior lobe. Expression in the hypothalamus is observed in the neuronal cells and neurons of arcuate nucleus, supraoptic nucleus and median eminence (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005125 cytokine activity; GO:0042056 chemoattractant activity
  • GO BP:  GO:0000165 MAPK cascade; GO:0001525 angiogenesis; GO:0001938 positive regulation of endothelial cell proliferation; GO:0035556 intracellular signal transduction; GO:0048245 eosinophil chemotaxis; GO:0050918 positive chemotaxis; GO:0050930 induction of positive chemotaxis; GO:2000352 negative regulation of endothelial cell apoptotic process; GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0031045 dense core granule; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVS
  • Length:  40
  • Propeptide:  MTESKAYRFGAVLLLIHLIFLVPGTEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIEKLRQQAHREESSPDYNPYQGISVPLQLKENGEESHLAESSRDVLSEDEWMRIILEALRQAENEPPSALKENKPYALNLEKNFPVDTPDDYETQQWPERKLKHMRFPLMYEENSRENPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQKRERVDEEQKLYTDDEDDVYKTNNIAYEDVVGGEDWSPMEEKIETQTQEEVRDSKENTEKNEQINEEMKRSGHLGLPDEGNRKESKDQLSEDASKVITYLRRLVNAVGSGRSQSGQNGDRAARLLERPLDSQSIYQLIEISRNLQIPPEDLIEMLKAGEKPNGLVEPEQDLELAVDLDDIPEADIDRPDMFQSKTLSKGGYPKAPGRGMMEALPDGLSVEDILNVLGMENVANQKSPYFPNQYSRDKALLRLPYGPGKSRANQIPKVAWIPDVESRQAPYDNLNDKDQELGEYLARMLVKYPELMNTNQLKRVPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVSKRIPAGSLKNEDTPNRQYLDEDMLLKVLEYLNQEQAEQGREHLAKRAMENM
  • Signal peptide:  MTESKAYRFGAVLLLIHLIFLVPGTEAASF
  • Modification:  T6 Phosphoserine;T29 Phosphoserine;T30 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules.
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10362-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000785_AF2.pdbhor000785_ESM.pdb

Physical Information

Mass: 506452 Formula: C182H296N50O72S
Absent amino acids: CFNRTWY Common amino acids: E
pI: 3.94 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -107.5 Boman Index: -9986
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 68.25
Instability Index: 8989.75 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15257142
  • Title:  Manserin, a Novel Peptide From Secretogranin II in the Neuroendocrine System